Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020

  1. Avatar for RockLr 51. RockLr Lv 1 44 pts. 9,605
  2. Avatar for not_publius 52. not_publius Lv 1 43 pts. 9,605
  3. Avatar for georg137 53. georg137 Lv 1 42 pts. 9,599
  4. Avatar for fearjuan 54. fearjuan Lv 1 42 pts. 9,599
  5. Avatar for neon_fuzz 55. neon_fuzz Lv 1 41 pts. 9,581
  6. Avatar for jamiexq 56. jamiexq Lv 1 40 pts. 9,579
  7. Avatar for infjamc 57. infjamc Lv 1 39 pts. 9,576
  8. Avatar for Hellcat6 58. Hellcat6 Lv 1 39 pts. 9,573
  9. Avatar for immerdasgleiche 59. immerdasgleiche Lv 1 38 pts. 9,568
  10. Avatar for OWM3 60. OWM3 Lv 1 37 pts. 9,558

Comments


Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ