Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,905
  2. Avatar for Go Science 2. Go Science 82 pts. 9,880
  3. Avatar for Contenders 3. Contenders 66 pts. 9,822
  4. Avatar for Herobrine's Army 4. Herobrine's Army 53 pts. 9,795
  5. Avatar for Marvin's bunch 5. Marvin's bunch 42 pts. 9,768
  6. Avatar for Gargleblasters 6. Gargleblasters 33 pts. 9,762
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 26 pts. 9,758
  8. Avatar for Anthropic Dreams 8. Anthropic Dreams 20 pts. 9,741
  9. Avatar for Void Crushers 9. Void Crushers 15 pts. 9,683
  10. Avatar for Hold My Beer 10. Hold My Beer 11 pts. 9,674
  1. Avatar for RockLr 51. RockLr Lv 1 44 pts. 9,605
  2. Avatar for not_publius 52. not_publius Lv 1 43 pts. 9,605
  3. Avatar for georg137 53. georg137 Lv 1 42 pts. 9,599
  4. Avatar for fearjuan 54. fearjuan Lv 1 42 pts. 9,599
  5. Avatar for neon_fuzz 55. neon_fuzz Lv 1 41 pts. 9,581
  6. Avatar for jamiexq 56. jamiexq Lv 1 40 pts. 9,579
  7. Avatar for infjamc 57. infjamc Lv 1 39 pts. 9,576
  8. Avatar for Hellcat6 58. Hellcat6 Lv 1 39 pts. 9,573
  9. Avatar for immerdasgleiche 59. immerdasgleiche Lv 1 38 pts. 9,568
  10. Avatar for OWM3 60. OWM3 Lv 1 37 pts. 9,558

Comments

Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ