Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,905
  2. Avatar for Go Science 2. Go Science 82 pts. 9,880
  3. Avatar for Contenders 3. Contenders 66 pts. 9,822
  4. Avatar for Herobrine's Army 4. Herobrine's Army 53 pts. 9,795
  5. Avatar for Marvin's bunch 5. Marvin's bunch 42 pts. 9,768
  6. Avatar for Gargleblasters 6. Gargleblasters 33 pts. 9,762
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 26 pts. 9,758
  8. Avatar for Anthropic Dreams 8. Anthropic Dreams 20 pts. 9,741
  9. Avatar for Void Crushers 9. Void Crushers 15 pts. 9,683
  10. Avatar for Hold My Beer 10. Hold My Beer 11 pts. 9,674
  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 86 pts. 9,793
  2. Avatar for Scopper 12. Scopper Lv 1 85 pts. 9,783
  3. Avatar for CharlieFortsConscience 13. CharlieFortsConscience Lv 1 83 pts. 9,782
  4. Avatar for Pikamander2 14. Pikamander2 Lv 1 82 pts. 9,772
  5. Avatar for christioanchauvin 15. christioanchauvin Lv 1 81 pts. 9,758
  6. Avatar for Trothal 16. Trothal Lv 1 79 pts. 9,753
  7. Avatar for TastyMunchies 17. TastyMunchies Lv 1 78 pts. 9,744
  8. Avatar for pvc78 18. pvc78 Lv 1 77 pts. 9,743
  9. Avatar for grogar7 19. grogar7 Lv 1 76 pts. 9,738
  10. Avatar for frood66 20. frood66 Lv 1 74 pts. 9,737

Comments

Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ