Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Herobrine's Army 11. Herobrine's Army 5 pts. 10,571
  2. Avatar for CHNO Junkies 12. CHNO Junkies 4 pts. 10,543
  3. Avatar for Penny-Arcade 13. Penny-Arcade 2 pts. 10,528
  4. Avatar for Russian team 14. Russian team 2 pts. 10,363
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,296
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,206
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 10,183
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 9,771
  9. Avatar for Coastal Biochemistry 19. Coastal Biochemistry 1 pt. 9,764
  10. Avatar for Team China 20. Team China 1 pt. 9,646

  1. Avatar for Dolichwier 161. Dolichwier Lv 1 2 pts. 9,862
  2. Avatar for rout 162. rout Lv 1 1 pt. 9,859
  3. Avatar for Flagg65a 163. Flagg65a Lv 1 1 pt. 9,851
  4. Avatar for CAN1958 164. CAN1958 Lv 1 1 pt. 9,851
  5. Avatar for Merf 165. Merf Lv 1 1 pt. 9,844
  6. Avatar for fearjuan 166. fearjuan Lv 1 1 pt. 9,841
  7. Avatar for fisherlr777 167. fisherlr777 Lv 1 1 pt. 9,829
  8. Avatar for Fuzzy5 168. Fuzzy5 Lv 1 1 pt. 9,828
  9. Avatar for kludbrook 169. kludbrook Lv 1 1 pt. 9,815
  10. Avatar for fpc 170. fpc Lv 1 1 pt. 9,814

Comments