Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Herobrine's Army 11. Herobrine's Army 5 pts. 10,571
  2. Avatar for CHNO Junkies 12. CHNO Junkies 4 pts. 10,543
  3. Avatar for Penny-Arcade 13. Penny-Arcade 2 pts. 10,528
  4. Avatar for Russian team 14. Russian team 2 pts. 10,363
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,296
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,206
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 10,183
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 9,771
  9. Avatar for Coastal Biochemistry 19. Coastal Biochemistry 1 pt. 9,764
  10. Avatar for Team China 20. Team China 1 pt. 9,646

  1. Avatar for sitlux 171. sitlux Lv 1 1 pt. 9,783
  2. Avatar for bolloforbio 172. bolloforbio Lv 1 1 pt. 9,778
  3. Avatar for Hum 173. Hum Lv 1 1 pt. 9,774
  4. Avatar for dange43 174. dange43 Lv 1 1 pt. 9,772
  5. Avatar for Savas 175. Savas Lv 1 1 pt. 9,771
  6. Avatar for anthion 176. anthion Lv 1 1 pt. 9,768
  7. Avatar for jrabrams 177. jrabrams Lv 1 1 pt. 9,764
  8. Avatar for aniri 178. aniri Lv 1 1 pt. 9,761
  9. Avatar for mimovilla 179. mimovilla Lv 1 1 pt. 9,751
  10. Avatar for kastberg 180. kastberg Lv 1 1 pt. 9,748

Comments