Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Herobrine's Army 11. Herobrine's Army 5 pts. 10,571
  2. Avatar for CHNO Junkies 12. CHNO Junkies 4 pts. 10,543
  3. Avatar for Penny-Arcade 13. Penny-Arcade 2 pts. 10,528
  4. Avatar for Russian team 14. Russian team 2 pts. 10,363
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,296
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,206
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 10,183
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 9,771
  9. Avatar for Coastal Biochemistry 19. Coastal Biochemistry 1 pt. 9,764
  10. Avatar for Team China 20. Team China 1 pt. 9,646
  1. Avatar for chimp36 191. chimp36 Lv 1 1 pt. 9,633
  2. Avatar for cinnamonkitty 192. cinnamonkitty Lv 1 1 pt. 9,617
  3. Avatar for Chris Klassen 193. Chris Klassen Lv 1 1 pt. 9,597
  4. Avatar for Sadaharu06.jp 194. Sadaharu06.jp Lv 1 1 pt. 9,592
  5. Avatar for tabs.st 195. tabs.st Lv 1 1 pt. 9,586
  6. Avatar for gerscht 196. gerscht Lv 1 1 pt. 9,570
  7. Avatar for pruneau_44 197. pruneau_44 Lv 1 1 pt. 9,561
  8. Avatar for jsfoldingaccount 198. jsfoldingaccount Lv 1 1 pt. 9,560
  9. Avatar for panguver 199. panguver Lv 1 1 pt. 9,560
  10. Avatar for hajtogato 200. hajtogato Lv 1 1 pt. 9,539

Comments