Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Herobrine's Army 11. Herobrine's Army 5 pts. 10,571
  2. Avatar for CHNO Junkies 12. CHNO Junkies 4 pts. 10,543
  3. Avatar for Penny-Arcade 13. Penny-Arcade 2 pts. 10,528
  4. Avatar for Russian team 14. Russian team 2 pts. 10,363
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,296
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,206
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 10,183
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 9,771
  9. Avatar for Coastal Biochemistry 19. Coastal Biochemistry 1 pt. 9,764
  10. Avatar for Team China 20. Team China 1 pt. 9,646
  1. Avatar for 420impatient 211. 420impatient Lv 1 1 pt. 9,458
  2. Avatar for IlseGh 212. IlseGh Lv 1 1 pt. 9,433
  3. Avatar for frankieboy150 213. frankieboy150 Lv 1 1 pt. 9,430
  4. Avatar for pascal ochem 214. pascal ochem Lv 1 1 pt. 9,422
  5. Avatar for dldahlen 215. dldahlen Lv 1 1 pt. 9,416
  6. Avatar for WilliamII 216. WilliamII Lv 1 1 pt. 9,407
  7. Avatar for mmkanekoa 217. mmkanekoa Lv 1 1 pt. 9,389
  8. Avatar for Onkelzfan3 218. Onkelzfan3 Lv 1 1 pt. 9,383
  9. Avatar for AlkiP0Ps 219. AlkiP0Ps Lv 1 1 pt. 9,372
  10. Avatar for LELE1964 220. LELE1964 Lv 1 1 pt. 9,370

Comments