Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Herobrine's Army 11. Herobrine's Army 5 pts. 10,571
  2. Avatar for CHNO Junkies 12. CHNO Junkies 4 pts. 10,543
  3. Avatar for Penny-Arcade 13. Penny-Arcade 2 pts. 10,528
  4. Avatar for Russian team 14. Russian team 2 pts. 10,363
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,296
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,206
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 10,183
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 9,771
  9. Avatar for Coastal Biochemistry 19. Coastal Biochemistry 1 pt. 9,764
  10. Avatar for Team China 20. Team China 1 pt. 9,646
  1. Avatar for dmit.feodorow 241. dmit.feodorow Lv 1 1 pt. 9,090
  2. Avatar for timetraveller_3000 242. timetraveller_3000 Lv 1 1 pt. 9,081
  3. Avatar for deathbat_87 243. deathbat_87 Lv 1 1 pt. 9,064
  4. Avatar for Strawberry7 244. Strawberry7 Lv 1 1 pt. 9,056
  5. Avatar for shshi20 245. shshi20 Lv 1 1 pt. 9,039
  6. Avatar for rlee287 246. rlee287 Lv 1 1 pt. 9,017
  7. Avatar for Dr.Sillem 247. Dr.Sillem Lv 1 1 pt. 8,983
  8. Avatar for itstonton 248. itstonton Lv 1 1 pt. 8,944
  9. Avatar for alyssa_d_V2.0 249. alyssa_d_V2.0 Lv 1 1 pt. 8,829
  10. Avatar for dkarend 250. dkarend Lv 1 1 pt. 8,717

Comments