Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Herobrine's Army 11. Herobrine's Army 5 pts. 10,571
  2. Avatar for CHNO Junkies 12. CHNO Junkies 4 pts. 10,543
  3. Avatar for Penny-Arcade 13. Penny-Arcade 2 pts. 10,528
  4. Avatar for Russian team 14. Russian team 2 pts. 10,363
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,296
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,206
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 10,183
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 9,771
  9. Avatar for Coastal Biochemistry 19. Coastal Biochemistry 1 pt. 9,764
  10. Avatar for Team China 20. Team China 1 pt. 9,646
  1. Avatar for SWR_DMaster 61. SWR_DMaster Lv 1 29 pts. 10,417
  2. Avatar for TastyMunchies 62. TastyMunchies Lv 1 28 pts. 10,416
  3. Avatar for knotartist 63. knotartist Lv 1 27 pts. 10,413
  4. Avatar for yaksari 64. yaksari Lv 1 27 pts. 10,407
  5. Avatar for Scopper 65. Scopper Lv 1 26 pts. 10,404
  6. Avatar for infjamc 66. infjamc Lv 1 25 pts. 10,399
  7. Avatar for bcre8tvv 67. bcre8tvv Lv 1 25 pts. 10,392
  8. Avatar for Tygh 68. Tygh Lv 1 24 pts. 10,389
  9. Avatar for SEF830 69. SEF830 Lv 1 23 pts. 10,376
  10. Avatar for nspc 70. nspc Lv 1 23 pts. 10,374

Comments