Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Herobrine's Army 11. Herobrine's Army 5 pts. 10,571
  2. Avatar for CHNO Junkies 12. CHNO Junkies 4 pts. 10,543
  3. Avatar for Penny-Arcade 13. Penny-Arcade 2 pts. 10,528
  4. Avatar for Russian team 14. Russian team 2 pts. 10,363
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,296
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,206
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 10,183
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 9,771
  9. Avatar for Coastal Biochemistry 19. Coastal Biochemistry 1 pt. 9,764
  10. Avatar for Team China 20. Team China 1 pt. 9,646

  1. Avatar for zeluis 71. zeluis Lv 1 22 pts. 10,370
  2. Avatar for petetrig 72. petetrig Lv 1 22 pts. 10,366
  3. Avatar for ComputerMage 73. ComputerMage Lv 1 21 pts. 10,363
  4. Avatar for drumpeter18yrs9yrs 74. drumpeter18yrs9yrs Lv 1 21 pts. 10,359
  5. Avatar for Fotis Papas 75. Fotis Papas Lv 1 20 pts. 10,351
  6. Avatar for Mikisp 76. Mikisp Lv 1 20 pts. 10,349
  7. Avatar for EagleGuy 77. EagleGuy Lv 1 19 pts. 10,339
  8. Avatar for Blue102 78. Blue102 Lv 1 19 pts. 10,330
  9. Avatar for Glen B 79. Glen B Lv 1 18 pts. 10,327
  10. Avatar for zyz79 80. zyz79 Lv 1 18 pts. 10,323

Comments