Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829

  1. Avatar for fearr 261. fearr Lv 1 1 pt. 6,347
  2. Avatar for Deleted player 262. Deleted player 1 pt. 5,520
  3. Avatar for DodoBird 263. DodoBird Lv 1 1 pt. 5,520
  4. Avatar for RockOn 264. RockOn Lv 1 1 pt. 5,520
  5. Avatar for Mike Cassidy 265. Mike Cassidy Lv 1 1 pt. 5,520
  6. Avatar for ZJUrjz 266. ZJUrjz Lv 1 1 pt. 5,520
  7. Avatar for KB80 267. KB80 Lv 1 1 pt. 5,520
  8. Avatar for puxatudo 268. puxatudo Lv 1 1 pt. 5,520

Comments