Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,886
  2. Avatar for Go Science 2. Go Science 80 pts. 10,884
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 10,794
  4. Avatar for Void Crushers 4. Void Crushers 49 pts. 10,789
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 10,783
  6. Avatar for Marvin's bunch 6. Marvin's bunch 28 pts. 10,723
  7. Avatar for Team India 7. Team India 21 pts. 10,718
  8. Avatar for Hold My Beer 8. Hold My Beer 15 pts. 10,670
  9. Avatar for Contenders 9. Contenders 11 pts. 10,661
  10. Avatar for Gargleblasters 10. Gargleblasters 8 pts. 10,659
  1. Avatar for Alistair69 101. Alistair69 Lv 1 10 pts. 10,205
  2. Avatar for Xartos 102. Xartos Lv 1 10 pts. 10,196
  3. Avatar for zannipietro 103. zannipietro Lv 1 10 pts. 10,187
  4. Avatar for Pibeagles1 104. Pibeagles1 Lv 1 9 pts. 10,185
  5. Avatar for not_publius 105. not_publius Lv 1 9 pts. 10,184
  6. Avatar for aendgraend 106. aendgraend Lv 1 9 pts. 10,183
  7. Avatar for mmudgett 107. mmudgett Lv 1 8 pts. 10,181
  8. Avatar for Pazithi 108. Pazithi Lv 1 8 pts. 10,181
  9. Avatar for Pawel Tluscik 109. Pawel Tluscik Lv 1 8 pts. 10,176
  10. Avatar for vybi 110. vybi Lv 1 8 pts. 10,171

Comments