Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,886
  2. Avatar for Go Science 2. Go Science 80 pts. 10,884
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 10,794
  4. Avatar for Void Crushers 4. Void Crushers 49 pts. 10,789
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 10,783
  6. Avatar for Marvin's bunch 6. Marvin's bunch 28 pts. 10,723
  7. Avatar for Team India 7. Team India 21 pts. 10,718
  8. Avatar for Hold My Beer 8. Hold My Beer 15 pts. 10,670
  9. Avatar for Contenders 9. Contenders 11 pts. 10,661
  10. Avatar for Gargleblasters 10. Gargleblasters 8 pts. 10,659
  1. Avatar for Slense 181. Slense Lv 1 1 pt. 9,740
  2. Avatar for dfonda 182. dfonda Lv 1 1 pt. 9,735
  3. Avatar for Willyanto 183. Willyanto Lv 1 1 pt. 9,721
  4. Avatar for Arne Heessels 184. Arne Heessels Lv 1 1 pt. 9,720
  5. Avatar for roman madala 185. roman madala Lv 1 1 pt. 9,718
  6. Avatar for donuts554 186. donuts554 Lv 1 1 pt. 9,679
  7. Avatar for bergie72 187. bergie72 Lv 1 1 pt. 9,676
  8. Avatar for ester141 188. ester141 Lv 1 1 pt. 9,656
  9. Avatar for RockLr 189. RockLr Lv 1 1 pt. 9,646
  10. Avatar for RiaSkies 190. RiaSkies Lv 1 1 pt. 9,637

Comments