Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 6 pts. 10,810
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 4 pts. 10,664
  3. Avatar for BOINC@Poland 13. BOINC@Poland 3 pts. 10,448
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 10,412
  5. Avatar for Russian team 15. Russian team 1 pt. 10,353
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,823
  7. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 9,808
  8. Avatar for Chem Eng Thermo 18. Chem Eng Thermo 1 pt. 9,687
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 9,502
  10. Avatar for Australia 20. Australia 1 pt. 9,342

  1. Avatar for foldthestuffman 151. foldthestuffman Lv 1 3 pts. 9,564
  2. Avatar for pandapharmd 152. pandapharmd Lv 1 3 pts. 9,561
  3. Avatar for Synarus 153. Synarus Lv 1 3 pts. 9,552
  4. Avatar for donuts554 154. donuts554 Lv 1 3 pts. 9,540
  5. Avatar for rinze 155. rinze Lv 1 2 pts. 9,539
  6. Avatar for Deleted player 156. Deleted player 2 pts. 9,537
  7. Avatar for micon 157. micon Lv 1 2 pts. 9,530
  8. Avatar for aspadistra 158. aspadistra Lv 1 2 pts. 9,502
  9. Avatar for Amphimixus 159. Amphimixus Lv 1 2 pts. 9,486
  10. Avatar for jausmh 160. jausmh Lv 1 2 pts. 9,485

Comments