Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Go Science 100 pts. 11,271
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 11,257
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 11,249
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 11,218
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 11,209
  6. Avatar for Penny-Arcade 6. Penny-Arcade 30 pts. 11,080
  7. Avatar for Contenders 7. Contenders 23 pts. 11,034
  8. Avatar for Marvin's bunch 8. Marvin's bunch 17 pts. 10,972
  9. Avatar for Team India 9. Team India 12 pts. 10,907
  10. Avatar for Hold My Beer 10. Hold My Beer 9 pts. 10,866

  1. Avatar for dcrwheeler
    1. dcrwheeler Lv 1
    100 pts. 11,268
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 99 pts. 11,261
  3. Avatar for LociOiling 3. LociOiling Lv 1 97 pts. 11,256
  4. Avatar for Galaxie 4. Galaxie Lv 1 95 pts. 11,247
  5. Avatar for nicobul 5. nicobul Lv 1 94 pts. 11,218
  6. Avatar for johnmitch 6. johnmitch Lv 1 92 pts. 11,196
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 90 pts. 11,192
  8. Avatar for guineapig 8. guineapig Lv 1 89 pts. 11,178
  9. Avatar for Aubade01 9. Aubade01 Lv 1 87 pts. 11,172
  10. Avatar for grogar7 10. grogar7 Lv 1 86 pts. 11,154

Comments