Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 6 pts. 10,810
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 4 pts. 10,664
  3. Avatar for BOINC@Poland 13. BOINC@Poland 3 pts. 10,448
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 10,412
  5. Avatar for Russian team 15. Russian team 1 pt. 10,353
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,823
  7. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 9,808
  8. Avatar for Chem Eng Thermo 18. Chem Eng Thermo 1 pt. 9,687
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 9,502
  10. Avatar for Australia 20. Australia 1 pt. 9,342
  1. Avatar for deconstruct 161. deconstruct Lv 1 2 pts. 9,483
  2. Avatar for steveB 162. steveB Lv 1 2 pts. 9,480
  3. Avatar for Chris Klassen 163. Chris Klassen Lv 1 2 pts. 9,455
  4. Avatar for sitlux 164. sitlux Lv 1 2 pts. 9,451
  5. Avatar for jsfoldingaccount 165. jsfoldingaccount Lv 1 2 pts. 9,450
  6. Avatar for tlai 166. tlai Lv 1 2 pts. 9,444
  7. Avatar for xabxs 167. xabxs Lv 1 2 pts. 9,437
  8. Avatar for Hum 168. Hum Lv 1 2 pts. 9,434
  9. Avatar for dfonda 169. dfonda Lv 1 2 pts. 9,410
  10. Avatar for Slense 170. Slense Lv 1 2 pts. 9,376

Comments