Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 6 pts. 10,810
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 4 pts. 10,664
  3. Avatar for BOINC@Poland 13. BOINC@Poland 3 pts. 10,448
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 10,412
  5. Avatar for Russian team 15. Russian team 1 pt. 10,353
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,823
  7. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 9,808
  8. Avatar for Chem Eng Thermo 18. Chem Eng Thermo 1 pt. 9,687
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 9,502
  10. Avatar for Australia 20. Australia 1 pt. 9,342

  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 84 pts. 11,115
  2. Avatar for LastAndroid 12. LastAndroid Lv 1 83 pts. 11,080
  3. Avatar for Phyx 13. Phyx Lv 1 81 pts. 11,076
  4. Avatar for Formula350 14. Formula350 Lv 1 80 pts. 11,070
  5. Avatar for Deleted player 15. Deleted player pts. 11,066
  6. Avatar for mirp 16. mirp Lv 1 77 pts. 11,064
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 75 pts. 11,034
  8. Avatar for Deleted player 18. Deleted player 74 pts. 11,023
  9. Avatar for fiendish_ghoul 19. fiendish_ghoul Lv 1 72 pts. 11,020
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 71 pts. 11,013

Comments