Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 6 pts. 10,810
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 4 pts. 10,664
  3. Avatar for BOINC@Poland 13. BOINC@Poland 3 pts. 10,448
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 10,412
  5. Avatar for Russian team 15. Russian team 1 pt. 10,353
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,823
  7. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 9,808
  8. Avatar for Chem Eng Thermo 18. Chem Eng Thermo 1 pt. 9,687
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 9,502
  10. Avatar for Australia 20. Australia 1 pt. 9,342
  1. Avatar for haggisfam 221. haggisfam Lv 1 1 pt. 9,064
  2. Avatar for DScott 222. DScott Lv 1 1 pt. 9,050
  3. Avatar for Feet1stEvolves 223. Feet1stEvolves Lv 1 1 pt. 9,050
  4. Avatar for Yamatada 224. Yamatada Lv 1 1 pt. 9,048
  5. Avatar for AdrianG125 225. AdrianG125 Lv 1 1 pt. 9,048
  6. Avatar for panguver 226. panguver Lv 1 1 pt. 9,036
  7. Avatar for zo3xiaJonWeinberg 227. zo3xiaJonWeinberg Lv 1 1 pt. 9,025
  8. Avatar for nicemeatballs 228. nicemeatballs Lv 1 1 pt. 9,014
  9. Avatar for amiller12 229. amiller12 Lv 1 1 pt. 9,012
  10. Avatar for HollyStorm14588 230. HollyStorm14588 Lv 1 1 pt. 8,989

Comments