Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 6 pts. 10,810
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 4 pts. 10,664
  3. Avatar for BOINC@Poland 13. BOINC@Poland 3 pts. 10,448
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 10,412
  5. Avatar for Russian team 15. Russian team 1 pt. 10,353
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,823
  7. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 9,808
  8. Avatar for Chem Eng Thermo 18. Chem Eng Thermo 1 pt. 9,687
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 9,502
  10. Avatar for Australia 20. Australia 1 pt. 9,342

  1. Avatar for g_b 31. g_b Lv 1 58 pts. 10,945
  2. Avatar for Jpilkington 32. Jpilkington Lv 1 56 pts. 10,919
  3. Avatar for TECHFREAK 33. TECHFREAK Lv 1 55 pts. 10,907
  4. Avatar for silent gene 34. silent gene Lv 1 54 pts. 10,891
  5. Avatar for Steven Pletsch 35. Steven Pletsch Lv 1 53 pts. 10,866
  6. Avatar for Mikisp 36. Mikisp Lv 1 52 pts. 10,856
  7. Avatar for KarenCH 37. KarenCH Lv 1 51 pts. 10,855
  8. Avatar for alcor29 38. alcor29 Lv 1 50 pts. 10,853
  9. Avatar for aznarog 39. aznarog Lv 1 49 pts. 10,832
  10. Avatar for georg137 40. georg137 Lv 1 48 pts. 10,816

Comments