Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for dcrwheeler
    1. dcrwheeler Lv 1
    100 pts. 11,268
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 99 pts. 11,261
  3. Avatar for LociOiling 3. LociOiling Lv 1 97 pts. 11,256
  4. Avatar for Galaxie 4. Galaxie Lv 1 95 pts. 11,247
  5. Avatar for nicobul 5. nicobul Lv 1 94 pts. 11,218
  6. Avatar for johnmitch 6. johnmitch Lv 1 92 pts. 11,196
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 90 pts. 11,192
  8. Avatar for guineapig 8. guineapig Lv 1 89 pts. 11,178
  9. Avatar for Aubade01 9. Aubade01 Lv 1 87 pts. 11,172
  10. Avatar for grogar7 10. grogar7 Lv 1 86 pts. 11,154

Comments