Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,271
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 11,257
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 11,249
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 11,218
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 11,209
  6. Avatar for Penny-Arcade 6. Penny-Arcade 30 pts. 11,080
  7. Avatar for Contenders 7. Contenders 23 pts. 11,034
  8. Avatar for Marvin's bunch 8. Marvin's bunch 17 pts. 10,972
  9. Avatar for Team India 9. Team India 12 pts. 10,907
  10. Avatar for Hold My Beer 10. Hold My Beer 9 pts. 10,866
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 22 pts. 11,257
  2. Avatar for LociOiling 12. LociOiling Lv 1 19 pts. 11,257
  3. Avatar for Deleted player 13. Deleted player 15 pts. 11,255
  4. Avatar for Galaxie 14. Galaxie Lv 1 13 pts. 11,249
  5. Avatar for Anfinsen_slept_here 15. Anfinsen_slept_here Lv 1 11 pts. 11,210
  6. Avatar for Blipperman 16. Blipperman Lv 1 9 pts. 11,209
  7. Avatar for Amphimixus 17. Amphimixus Lv 1 7 pts. 11,204
  8. Avatar for Jpilkington 18. Jpilkington Lv 1 6 pts. 11,201
  9. Avatar for robgee 19. robgee Lv 1 5 pts. 11,201
  10. Avatar for ManVsYard 20. ManVsYard Lv 1 4 pts. 11,183

Comments