Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Go Science 100 pts. 11,271
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 11,257
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 11,249
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 11,218
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 11,209
  6. Avatar for Penny-Arcade 6. Penny-Arcade 30 pts. 11,080
  7. Avatar for Contenders 7. Contenders 23 pts. 11,034
  8. Avatar for Marvin's bunch 8. Marvin's bunch 17 pts. 10,972
  9. Avatar for Team India 9. Team India 12 pts. 10,907
  10. Avatar for Hold My Beer 10. Hold My Beer 9 pts. 10,866

  1. Avatar for Alistair69 91. Alistair69 Lv 1 15 pts. 10,179
  2. Avatar for xythus 92. xythus Lv 1 15 pts. 10,168
  3. Avatar for Pikamander2 93. Pikamander2 Lv 1 15 pts. 10,147
  4. Avatar for GuR0 94. GuR0 Lv 1 14 pts. 10,075
  5. Avatar for OWM3 95. OWM3 Lv 1 14 pts. 10,068
  6. Avatar for lraguette 96. lraguette Lv 1 13 pts. 10,051
  7. Avatar for Fotis Papas 97. Fotis Papas Lv 1 13 pts. 10,049
  8. Avatar for obbo 98. obbo Lv 1 13 pts. 10,039
  9. Avatar for argyrw 99. argyrw Lv 1 12 pts. 10,034
  10. Avatar for pfirth 100. pfirth Lv 1 12 pts. 10,009

Comments