Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Go Science 100 pts. 11,271
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 11,257
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 11,249
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 11,218
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 11,209
  6. Avatar for Penny-Arcade 6. Penny-Arcade 30 pts. 11,080
  7. Avatar for Contenders 7. Contenders 23 pts. 11,034
  8. Avatar for Marvin's bunch 8. Marvin's bunch 17 pts. 10,972
  9. Avatar for Team India 9. Team India 12 pts. 10,907
  10. Avatar for Hold My Beer 10. Hold My Beer 9 pts. 10,866

  1. Avatar for JasperD 131. JasperD Lv 1 5 pts. 9,732
  2. Avatar for pangaena 132. pangaena Lv 1 5 pts. 9,732
  3. Avatar for not_publius 133. not_publius Lv 1 5 pts. 9,726
  4. Avatar for Arne Heessels 134. Arne Heessels Lv 1 5 pts. 9,707
  5. Avatar for Trematode1980 135. Trematode1980 Lv 1 5 pts. 9,700
  6. Avatar for rabamino12358 136. rabamino12358 Lv 1 4 pts. 9,699
  7. Avatar for G d S 137. G d S Lv 1 4 pts. 9,687
  8. Avatar for Altercomp 138. Altercomp Lv 1 4 pts. 9,675
  9. Avatar for bstolz 139. bstolz Lv 1 4 pts. 9,670
  10. Avatar for dahast.de 140. dahast.de Lv 1 4 pts. 9,664

Comments