Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Go Science 100 pts. 11,271
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 11,257
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 11,249
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 11,218
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 11,209
  6. Avatar for Penny-Arcade 6. Penny-Arcade 30 pts. 11,080
  7. Avatar for Contenders 7. Contenders 23 pts. 11,034
  8. Avatar for Marvin's bunch 8. Marvin's bunch 17 pts. 10,972
  9. Avatar for Team India 9. Team India 12 pts. 10,907
  10. Avatar for Hold My Beer 10. Hold My Beer 9 pts. 10,866

  1. Avatar for deconstruct 161. deconstruct Lv 1 2 pts. 9,483
  2. Avatar for steveB 162. steveB Lv 1 2 pts. 9,480
  3. Avatar for Chris Klassen 163. Chris Klassen Lv 1 2 pts. 9,455
  4. Avatar for sitlux 164. sitlux Lv 1 2 pts. 9,451
  5. Avatar for jsfoldingaccount 165. jsfoldingaccount Lv 1 2 pts. 9,450
  6. Avatar for tlai 166. tlai Lv 1 2 pts. 9,444
  7. Avatar for xabxs 167. xabxs Lv 1 2 pts. 9,437
  8. Avatar for Hum 168. Hum Lv 1 2 pts. 9,434
  9. Avatar for dfonda 169. dfonda Lv 1 2 pts. 9,410
  10. Avatar for Slense 170. Slense Lv 1 2 pts. 9,376

Comments