Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,271
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 11,257
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 11,249
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 11,218
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 11,209
  6. Avatar for Penny-Arcade 6. Penny-Arcade 30 pts. 11,080
  7. Avatar for Contenders 7. Contenders 23 pts. 11,034
  8. Avatar for Marvin's bunch 8. Marvin's bunch 17 pts. 10,972
  9. Avatar for Team India 9. Team India 12 pts. 10,907
  10. Avatar for Hold My Beer 10. Hold My Beer 9 pts. 10,866
  1. Avatar for cbwest 191. cbwest Lv 1 1 pt. 9,187
  2. Avatar for pruneau_44 192. pruneau_44 Lv 1 1 pt. 9,160
  3. Avatar for boccaccio 193. boccaccio Lv 1 1 pt. 9,153
  4. Avatar for Ertonier 194. Ertonier Lv 1 1 pt. 9,149
  5. Avatar for teunlammetje 195. teunlammetje Lv 1 1 pt. 9,147
  6. Avatar for 43654325 196. 43654325 Lv 1 1 pt. 9,136
  7. Avatar for froschi2 197. froschi2 Lv 1 1 pt. 9,135
  8. Avatar for Pyrodinium123 198. Pyrodinium123 Lv 1 1 pt. 9,134
  9. Avatar for Yusra.L 199. Yusra.L Lv 1 1 pt. 9,123
  10. Avatar for AlkiP0Ps 200. AlkiP0Ps Lv 1 1 pt. 9,120

Comments