Placeholder image of a protein
Icon representing a puzzle

1836: Revisiting Puzzle 115: Exocyst

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 08, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 6 pts. 10,745
  2. Avatar for Penny-Arcade 12. Penny-Arcade 4 pts. 10,745
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 3 pts. 10,597
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 10,504
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,435
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 10,149
  7. Avatar for Russian team 17. Russian team 1 pt. 10,087
  8. Avatar for Chem Eng Thermo 18. Chem Eng Thermo 1 pt. 9,752
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,591
  10. Avatar for Fox Folds 20. Fox Folds 1 pt. 9,458
  1. Avatar for Hansgeorg 131. Hansgeorg Lv 1 4 pts. 9,957
  2. Avatar for ProfVince 132. ProfVince Lv 1 4 pts. 9,954
  3. Avatar for Feet1stEvolves 133. Feet1stEvolves Lv 1 4 pts. 9,948
  4. Avatar for Auntecedent 134. Auntecedent Lv 1 4 pts. 9,940
  5. Avatar for RyeSnake 135. RyeSnake Lv 1 4 pts. 9,928
  6. Avatar for donuts554 136. donuts554 Lv 1 3 pts. 9,909
  7. Avatar for Hum 137. Hum Lv 1 3 pts. 9,893
  8. Avatar for jsfoldingaccount 138. jsfoldingaccount Lv 1 3 pts. 9,875
  9. Avatar for NPrincipi 139. NPrincipi Lv 1 3 pts. 9,870
  10. Avatar for pfirth 140. pfirth Lv 1 3 pts. 9,866

Comments

NinjaGreg Lv 1

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

g_b Lv 1

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

bkoep Staff Lv 1

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.