Placeholder image of a protein
Icon representing a puzzle

1836: Revisiting Puzzle 115: Exocyst

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 08, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,116
  2. Avatar for Go Science 2. Go Science 81 pts. 11,066
  3. Avatar for Void Crushers 3. Void Crushers 64 pts. 11,011
  4. Avatar for Contenders 4. Contenders 50 pts. 10,984
  5. Avatar for Hold My Beer 5. Hold My Beer 39 pts. 10,961
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 30 pts. 10,953
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 10,950
  8. Avatar for Beta Folders 8. Beta Folders 17 pts. 10,946
  9. Avatar for Team India 9. Team India 12 pts. 10,917
  10. Avatar for CHNO Junkies 10. CHNO Junkies 9 pts. 10,888
  1. Avatar for robgee 31. robgee Lv 1 55 pts. 10,828
  2. Avatar for Mikisp 32. Mikisp Lv 1 54 pts. 10,820
  3. Avatar for guineapig 33. guineapig Lv 1 53 pts. 10,816
  4. Avatar for BootsMcGraw 34. BootsMcGraw Lv 1 52 pts. 10,814
  5. Avatar for Steven Pletsch 35. Steven Pletsch Lv 1 51 pts. 10,777
  6. Avatar for Ignacio 36. Ignacio Lv 1 50 pts. 10,769
  7. Avatar for GuR0 37. GuR0 Lv 1 49 pts. 10,765
  8. Avatar for Deleted player 38. Deleted player 48 pts. 10,745
  9. Avatar for LastAndroid 39. LastAndroid Lv 1 47 pts. 10,745
  10. Avatar for aznarog 40. aznarog Lv 1 46 pts. 10,741

Comments

NinjaGreg Lv 1

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

g_b Lv 1

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

bkoep Staff Lv 1

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.