Placeholder image of a protein
Icon representing a puzzle

1836: Revisiting Puzzle 115: Exocyst

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 08, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,116
  2. Avatar for Go Science 2. Go Science 81 pts. 11,066
  3. Avatar for Void Crushers 3. Void Crushers 64 pts. 11,011
  4. Avatar for Contenders 4. Contenders 50 pts. 10,984
  5. Avatar for Hold My Beer 5. Hold My Beer 39 pts. 10,961
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 30 pts. 10,953
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 10,950
  8. Avatar for Beta Folders 8. Beta Folders 17 pts. 10,946
  9. Avatar for Team India 9. Team India 12 pts. 10,917
  10. Avatar for CHNO Junkies 10. CHNO Junkies 9 pts. 10,888

  1. Avatar for marsfan 51. marsfan Lv 1 36 pts. 10,637
  2. Avatar for phi16 52. phi16 Lv 1 35 pts. 10,635
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 34 pts. 10,630
  4. Avatar for stomjoh 54. stomjoh Lv 1 33 pts. 10,617
  5. Avatar for diamonddays 55. diamonddays Lv 1 33 pts. 10,607
  6. Avatar for JasperD 56. JasperD Lv 1 32 pts. 10,597
  7. Avatar for Jpilkington 57. Jpilkington Lv 1 31 pts. 10,575
  8. Avatar for alcor29 58. alcor29 Lv 1 30 pts. 10,574
  9. Avatar for lraguette 59. lraguette Lv 1 30 pts. 10,566
  10. Avatar for nicobul 60. nicobul Lv 1 29 pts. 10,547

Comments


NinjaGreg Lv 1

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

g_b Lv 1

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

bkoep Staff Lv 1

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.