Placeholder image of a protein
Icon representing a puzzle

1842: Revisiting Puzzle 124: PDZ Domain

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,642
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 10,491
  3. Avatar for Russian team 13. Russian team 1 pt. 10,254
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 10,209
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,196
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 10,083
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 9,754
  8. Avatar for Window Group 18. Window Group 1 pt. 8,911

  1. Avatar for Deleted player 191. Deleted player pts. 9,188
  2. Avatar for vmils 192. vmils Lv 1 1 pt. 9,171
  3. Avatar for Cacho 193. Cacho Lv 1 1 pt. 9,149
  4. Avatar for SAAMCraft 194. SAAMCraft Lv 1 1 pt. 9,096
  5. Avatar for YAGP99 195. YAGP99 Lv 1 1 pt. 9,094
  6. Avatar for GAVENvonAHYO 196. GAVENvonAHYO Lv 1 1 pt. 9,071
  7. Avatar for jflat06 197. jflat06 Lv 1 1 pt. 8,911
  8. Avatar for Giparang 199. Giparang Lv 1 1 pt. 8,763
  9. Avatar for AX_14_25 200. AX_14_25 Lv 1 1 pt. 8,616

Comments