Placeholder image of a protein
Icon representing a puzzle

1842: Revisiting Puzzle 124: PDZ Domain

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,978
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,976
  3. Avatar for Contenders 3. Contenders 54 pts. 10,972
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 10,957
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 10,888
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,843
  7. Avatar for Team India 7. Team India 12 pts. 10,802
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,775
  9. Avatar for CHNO Junkies 9. CHNO Junkies 5 pts. 10,737
  10. Avatar for Penny-Arcade 10. Penny-Arcade 3 pts. 10,721
  1. Avatar for Deleted player 191. Deleted player pts. 9,188
  2. Avatar for vmils 192. vmils Lv 1 1 pt. 9,171
  3. Avatar for Cacho 193. Cacho Lv 1 1 pt. 9,149
  4. Avatar for SAAMCraft 194. SAAMCraft Lv 1 1 pt. 9,096
  5. Avatar for YAGP99 195. YAGP99 Lv 1 1 pt. 9,094
  6. Avatar for GAVENvonAHYO 196. GAVENvonAHYO Lv 1 1 pt. 9,071
  7. Avatar for jflat06 197. jflat06 Lv 1 1 pt. 8,911
  8. Avatar for bacteria-casX-covid 198. bacteria-casX-covid Lv 1 1 pt. 8,861
  9. Avatar for Giparang 199. Giparang Lv 1 1 pt. 8,763
  10. Avatar for AX_14_25 200. AX_14_25 Lv 1 1 pt. 8,616

Comments