Placeholder image of a protein
Icon representing a puzzle

1842: Revisiting Puzzle 124: PDZ Domain

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,978
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,976
  3. Avatar for Contenders 3. Contenders 54 pts. 10,972
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 10,957
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 10,888
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,843
  7. Avatar for Team India 7. Team India 12 pts. 10,802
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,775
  9. Avatar for CHNO Junkies 9. CHNO Junkies 5 pts. 10,737
  10. Avatar for Penny-Arcade 10. Penny-Arcade 3 pts. 10,721
  1. Avatar for pascal ochem 181. pascal ochem Lv 1 1 pt. 9,328
  2. Avatar for Galbania 182. Galbania Lv 1 1 pt. 9,326
  3. Avatar for YellowBearPL 183. YellowBearPL Lv 1 1 pt. 9,324
  4. Avatar for tombickle 184. tombickle Lv 1 1 pt. 9,317
  5. Avatar for drumpeter18yrs9yrs 185. drumpeter18yrs9yrs Lv 1 1 pt. 9,313
  6. Avatar for uwskie 186. uwskie Lv 1 1 pt. 9,310
  7. Avatar for ester141 187. ester141 Lv 1 1 pt. 9,210
  8. Avatar for bullseye09 188. bullseye09 Lv 1 1 pt. 9,189
  9. Avatar for 29eppe@gmail.com 189. 29eppe@gmail.com Lv 1 1 pt. 9,188
  10. Avatar for gurch 190. gurch Lv 1 1 pt. 9,188

Comments