Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,835
  2. Avatar for Russian team 12. Russian team 1 pt. 9,803
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,618
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,587
  5. Avatar for Chem Eng Thermo 15. Chem Eng Thermo 1 pt. 9,520
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,440
  7. Avatar for Deleted group 17. Deleted group pts. 9,390
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,155

  1. Avatar for pfirth 121. pfirth Lv 1 2 pts. 9,533
  2. Avatar for G d S 122. G d S Lv 1 2 pts. 9,520
  3. Avatar for Dolichwier 123. Dolichwier Lv 1 2 pts. 9,507
  4. Avatar for dfonda 124. dfonda Lv 1 2 pts. 9,491
  5. Avatar for Arne Heessels 125. Arne Heessels Lv 1 2 pts. 9,488
  6. Avatar for Alexperience 126. Alexperience Lv 1 2 pts. 9,471
  7. Avatar for muffnerk 127. muffnerk Lv 1 2 pts. 9,465
  8. Avatar for Golgi42370 128. Golgi42370 Lv 1 2 pts. 9,463
  9. Avatar for OeshaHari 129. OeshaHari Lv 1 1 pt. 9,454
  10. Avatar for Hansgeorg 130. Hansgeorg Lv 1 1 pt. 9,449

Comments