Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,241
  2. Avatar for Contenders 2. Contenders 74 pts. 10,207
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,185
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,162
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,125
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,122
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,108
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,058
  9. Avatar for Hold My Beer 9. Hold My Beer 5 pts. 10,013
  10. Avatar for CHNO Junkies 10. CHNO Junkies 3 pts. 9,998
  1. Avatar for pfirth 121. pfirth Lv 1 2 pts. 9,533
  2. Avatar for G d S 122. G d S Lv 1 2 pts. 9,520
  3. Avatar for Dolichwier 123. Dolichwier Lv 1 2 pts. 9,507
  4. Avatar for dfonda 124. dfonda Lv 1 2 pts. 9,491
  5. Avatar for Arne Heessels 125. Arne Heessels Lv 1 2 pts. 9,488
  6. Avatar for Alexperience 126. Alexperience Lv 1 2 pts. 9,471
  7. Avatar for muffnerk 127. muffnerk Lv 1 2 pts. 9,465
  8. Avatar for Golgi42370 128. Golgi42370 Lv 1 2 pts. 9,463
  9. Avatar for OeshaHari 129. OeshaHari Lv 1 1 pt. 9,454
  10. Avatar for Hansgeorg 130. Hansgeorg Lv 1 1 pt. 9,449

Comments