Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,835
  2. Avatar for Russian team 12. Russian team 1 pt. 9,803
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,618
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,587
  5. Avatar for Chem Eng Thermo 15. Chem Eng Thermo 1 pt. 9,520
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,440
  7. Avatar for Deleted group 17. Deleted group pts. 9,390
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,155
  1. Avatar for BlueEqualsRed 171. BlueEqualsRed Lv 1 1 pt. 8,950
  2. Avatar for paja22 172. paja22 Lv 1 1 pt. 8,936
  3. Avatar for Simek 173. Simek Lv 1 1 pt. 8,902
  4. Avatar for foldthestuffman 174. foldthestuffman Lv 1 1 pt. 8,891
  5. Avatar for Huempfnern 175. Huempfnern Lv 1 1 pt. 8,860
  6. Avatar for tombickle 176. tombickle Lv 1 1 pt. 8,854
  7. Avatar for deathbat_87 177. deathbat_87 Lv 1 1 pt. 8,850
  8. Avatar for GLOwneRY 178. GLOwneRY Lv 1 1 pt. 8,815
  9. Avatar for Auntecedent 179. Auntecedent Lv 1 1 pt. 8,797
  10. Avatar for fischy92 180. fischy92 Lv 1 1 pt. 8,797

Comments