Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,241
  2. Avatar for Contenders 2. Contenders 74 pts. 10,207
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,185
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,162
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,125
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,122
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,108
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,058
  9. Avatar for Hold My Beer 9. Hold My Beer 5 pts. 10,013
  10. Avatar for CHNO Junkies 10. CHNO Junkies 3 pts. 9,998
  1. Avatar for BlueEqualsRed 171. BlueEqualsRed Lv 1 1 pt. 8,950
  2. Avatar for paja22 172. paja22 Lv 1 1 pt. 8,936
  3. Avatar for Simek 173. Simek Lv 1 1 pt. 8,902
  4. Avatar for foldthestuffman 174. foldthestuffman Lv 1 1 pt. 8,891
  5. Avatar for Huempfnern 175. Huempfnern Lv 1 1 pt. 8,860
  6. Avatar for tombickle 176. tombickle Lv 1 1 pt. 8,854
  7. Avatar for deathbat_87 177. deathbat_87 Lv 1 1 pt. 8,850
  8. Avatar for GLOwneRY 178. GLOwneRY Lv 1 1 pt. 8,815
  9. Avatar for Auntecedent 179. Auntecedent Lv 1 1 pt. 8,797
  10. Avatar for fischy92 180. fischy92 Lv 1 1 pt. 8,797

Comments