Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,835
  2. Avatar for Russian team 12. Russian team 1 pt. 9,803
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,618
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,587
  5. Avatar for Chem Eng Thermo 15. Chem Eng Thermo 1 pt. 9,520
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,440
  7. Avatar for Deleted group 17. Deleted group pts. 9,390
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,155

  1. Avatar for CESAR RAMIREZ 181. CESAR RAMIREZ Lv 1 1 pt. 8,776
  2. Avatar for rezaefar 182. rezaefar Lv 1 1 pt. 8,707
  3. Avatar for Marinesamoylova 183. Marinesamoylova Lv 1 1 pt. 8,703
  4. Avatar for Karemani Alex 184. Karemani Alex Lv 1 1 pt. 8,624
  5. Avatar for RyanFeathers 185. RyanFeathers Lv 1 1 pt. 8,585
  6. Avatar for pascal ochem 186. pascal ochem Lv 1 1 pt. 8,491
  7. Avatar for Bucsan 187. Bucsan Lv 1 1 pt. 8,467
  8. Avatar for CAN1958 188. CAN1958 Lv 1 1 pt. 8,463
  9. Avatar for Deleted player 189. Deleted player pts. 8,448
  10. Avatar for tkr 190. tkr Lv 1 1 pt. 8,400

Comments