Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,241
  2. Avatar for Contenders 2. Contenders 74 pts. 10,207
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,185
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,162
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,125
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,122
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,108
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,058
  9. Avatar for Hold My Beer 9. Hold My Beer 5 pts. 10,013
  10. Avatar for CHNO Junkies 10. CHNO Junkies 3 pts. 9,998
  1. Avatar for CESAR RAMIREZ 181. CESAR RAMIREZ Lv 1 1 pt. 8,776
  2. Avatar for rezaefar 182. rezaefar Lv 1 1 pt. 8,707
  3. Avatar for Marinesamoylova 183. Marinesamoylova Lv 1 1 pt. 8,703
  4. Avatar for Karemani Alex 184. Karemani Alex Lv 1 1 pt. 8,624
  5. Avatar for RyanFeathers 185. RyanFeathers Lv 1 1 pt. 8,585
  6. Avatar for pascal ochem 186. pascal ochem Lv 1 1 pt. 8,491
  7. Avatar for Bucsan 187. Bucsan Lv 1 1 pt. 8,467
  8. Avatar for CAN1958 188. CAN1958 Lv 1 1 pt. 8,463
  9. Avatar for Deleted player 189. Deleted player pts. 8,448
  10. Avatar for tkr 190. tkr Lv 1 1 pt. 8,400

Comments