Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,835
  2. Avatar for Russian team 12. Russian team 1 pt. 9,803
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,618
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,587
  5. Avatar for Chem Eng Thermo 15. Chem Eng Thermo 1 pt. 9,520
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,440
  7. Avatar for Deleted group 17. Deleted group pts. 9,390
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,155
  1. Avatar for SethDrey 191. SethDrey Lv 1 1 pt. 8,366
  2. Avatar for patrickwillemse 192. patrickwillemse Lv 1 1 pt. 8,365
  3. Avatar for harvardman 193. harvardman Lv 1 1 pt. 8,365
  4. Avatar for BKolbaba 194. BKolbaba Lv 1 1 pt. 8,365
  5. Avatar for sjrt 195. sjrt Lv 1 1 pt. 8,201
  6. Avatar for 01010011111 196. 01010011111 Lv 1 1 pt. 8,118
  7. Avatar for wzaslavsky 197. wzaslavsky Lv 1 1 pt. 8,069
  8. Avatar for wildpower 198. wildpower Lv 1 1 pt. 7,911
  9. Avatar for Wassn 199. Wassn Lv 1 1 pt. 7,678
  10. Avatar for RichardLau 200. RichardLau Lv 1 1 pt. 7,613

Comments