Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,241
  2. Avatar for Contenders 2. Contenders 74 pts. 10,207
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,185
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,162
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,125
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,122
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,108
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,058
  9. Avatar for Hold My Beer 9. Hold My Beer 5 pts. 10,013
  10. Avatar for CHNO Junkies 10. CHNO Junkies 3 pts. 9,998
  1. Avatar for SethDrey 191. SethDrey Lv 1 1 pt. 8,366
  2. Avatar for patrickwillemse 192. patrickwillemse Lv 1 1 pt. 8,365
  3. Avatar for harvardman 193. harvardman Lv 1 1 pt. 8,365
  4. Avatar for BKolbaba 194. BKolbaba Lv 1 1 pt. 8,365
  5. Avatar for sjrt 195. sjrt Lv 1 1 pt. 8,201
  6. Avatar for 01010011111 196. 01010011111 Lv 1 1 pt. 8,118
  7. Avatar for wzaslavsky 197. wzaslavsky Lv 1 1 pt. 8,069
  8. Avatar for wildpower 198. wildpower Lv 1 1 pt. 7,911
  9. Avatar for Wassn 199. Wassn Lv 1 1 pt. 7,678
  10. Avatar for RichardLau 200. RichardLau Lv 1 1 pt. 7,613

Comments