Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,835
  2. Avatar for Russian team 12. Russian team 1 pt. 9,803
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,618
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,587
  5. Avatar for Chem Eng Thermo 15. Chem Eng Thermo 1 pt. 9,520
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,440
  7. Avatar for Deleted group 17. Deleted group pts. 9,390
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,155
  1. Avatar for tangofox10 61. tangofox10 Lv 1 19 pts. 9,968
  2. Avatar for Alistair69 62. Alistair69 Lv 1 19 pts. 9,959
  3. Avatar for Scopper 63. Scopper Lv 1 18 pts. 9,958
  4. Avatar for stomjoh 64. stomjoh Lv 1 18 pts. 9,955
  5. Avatar for Crossed Sticks 65. Crossed Sticks Lv 1 17 pts. 9,948
  6. Avatar for Jpilkington 66. Jpilkington Lv 1 17 pts. 9,941
  7. Avatar for DrSagar 67. DrSagar Lv 1 16 pts. 9,922
  8. Avatar for diamonddays 68. diamonddays Lv 1 15 pts. 9,916
  9. Avatar for tom2705 69. tom2705 Lv 1 15 pts. 9,903
  10. Avatar for pente_player 70. pente_player Lv 1 14 pts. 9,902

Comments