Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,241
  2. Avatar for Contenders 2. Contenders 74 pts. 10,207
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,185
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,162
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,125
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,122
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,108
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,058
  9. Avatar for Hold My Beer 9. Hold My Beer 5 pts. 10,013
  10. Avatar for CHNO Junkies 10. CHNO Junkies 3 pts. 9,998
  1. Avatar for tangofox10 61. tangofox10 Lv 1 19 pts. 9,968
  2. Avatar for Alistair69 62. Alistair69 Lv 1 19 pts. 9,959
  3. Avatar for Scopper 63. Scopper Lv 1 18 pts. 9,958
  4. Avatar for stomjoh 64. stomjoh Lv 1 18 pts. 9,955
  5. Avatar for Crossed Sticks 65. Crossed Sticks Lv 1 17 pts. 9,948
  6. Avatar for Jpilkington 66. Jpilkington Lv 1 17 pts. 9,941
  7. Avatar for DrSagar 67. DrSagar Lv 1 16 pts. 9,922
  8. Avatar for diamonddays 68. diamonddays Lv 1 15 pts. 9,916
  9. Avatar for tom2705 69. tom2705 Lv 1 15 pts. 9,903
  10. Avatar for pente_player 70. pente_player Lv 1 14 pts. 9,902

Comments