Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Go Science 100 pts. 10,241
  2. Avatar for Contenders 2. Contenders 74 pts. 10,207
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,185
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,162
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,125
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,122
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,108
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,058
  9. Avatar for Hold My Beer 9. Hold My Beer 5 pts. 10,013
  10. Avatar for CHNO Junkies 10. CHNO Junkies 3 pts. 9,998

  1. Avatar for avalux 151. avalux Lv 1 1 pt. 9,238
  2. Avatar for IlseGh 152. IlseGh Lv 1 1 pt. 9,229
  3. Avatar for Jenot96 153. Jenot96 Lv 1 1 pt. 9,227
  4. Avatar for pruneau_44 154. pruneau_44 Lv 1 1 pt. 9,223
  5. Avatar for fisherlr777 155. fisherlr777 Lv 1 1 pt. 9,217
  6. Avatar for Dr.Sillem 156. Dr.Sillem Lv 1 1 pt. 9,215
  7. Avatar for WilliamII 157. WilliamII Lv 1 1 pt. 9,204
  8. Avatar for tlaran 158. tlaran Lv 1 1 pt. 9,194
  9. Avatar for cbwest 159. cbwest Lv 1 1 pt. 9,185
  10. Avatar for BrittaBarny 160. BrittaBarny Lv 1 1 pt. 9,182

Comments