Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Go Science 100 pts. 10,241
  2. Avatar for Contenders 2. Contenders 74 pts. 10,207
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,185
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,162
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,125
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,122
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,108
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,058
  9. Avatar for Hold My Beer 9. Hold My Beer 5 pts. 10,013
  10. Avatar for CHNO Junkies 10. CHNO Junkies 3 pts. 9,998

  1. Avatar for LastAndroid 31. LastAndroid Lv 1 47 pts. 10,066
  2. Avatar for Joanna_H 32. Joanna_H Lv 1 46 pts. 10,065
  3. Avatar for John McLeod 34. John McLeod Lv 1 43 pts. 10,058
  4. Avatar for georg137 35. georg137 Lv 1 42 pts. 10,046
  5. Avatar for christioanchauvin 36. christioanchauvin Lv 1 41 pts. 10,045
  6. Avatar for SKSbell 37. SKSbell Lv 1 40 pts. 10,043
  7. Avatar for pvc78 38. pvc78 Lv 1 39 pts. 10,042
  8. Avatar for Hustvedt 39. Hustvedt Lv 1 38 pts. 10,042
  9. Avatar for guineapig 40. guineapig Lv 1 37 pts. 10,040

Comments