Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,241
  2. Avatar for Contenders 2. Contenders 74 pts. 10,207
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,185
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,162
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,125
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,122
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,108
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,058
  9. Avatar for Hold My Beer 9. Hold My Beer 5 pts. 10,013
  10. Avatar for CHNO Junkies 10. CHNO Junkies 3 pts. 9,998
  1. Avatar for KarenCH 21. KarenCH Lv 1 61 pts. 10,089
  2. Avatar for drjr 22. drjr Lv 1 60 pts. 10,086
  3. Avatar for mirp 23. mirp Lv 1 58 pts. 10,084
  4. Avatar for nicobul 24. nicobul Lv 1 57 pts. 10,077
  5. Avatar for Timo van der Laan 25. Timo van der Laan Lv 1 55 pts. 10,074
  6. Avatar for GuR0 26. GuR0 Lv 1 54 pts. 10,074
  7. Avatar for Phyx 27. Phyx Lv 1 52 pts. 10,072
  8. Avatar for Deleted player 28. Deleted player pts. 10,070
  9. Avatar for robgee 29. robgee Lv 1 50 pts. 10,069
  10. Avatar for BootsMcGraw 30. BootsMcGraw Lv 1 48 pts. 10,066

Comments