Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Russian team 11. Russian team 4 pts. 9,341
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 9,334
  3. Avatar for CHNO Junkies 13. CHNO Junkies 2 pts. 9,215
  4. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,807
  5. Avatar for Team Canada 16. Team Canada 1 pt. 7,988
  6. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 7,633
  7. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 7,199
  8. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 7,134
  9. Avatar for Italiani Al Lavoro 20. Italiani Al Lavoro 1 pt. 2,801

  1. Avatar for Pazithi
    1. Pazithi Lv 1
    100 pts. 10,785
  2. Avatar for Blipperman 2. Blipperman Lv 1 85 pts. 10,785
  3. Avatar for ManVsYard 3. ManVsYard Lv 1 71 pts. 10,769
  4. Avatar for Mike Lewis 4. Mike Lewis Lv 1 60 pts. 10,769
  5. Avatar for Jpilkington 5. Jpilkington Lv 1 49 pts. 10,751
  6. Avatar for Dhalion 6. Dhalion Lv 1 41 pts. 10,734
  7. Avatar for Czim 7. Czim Lv 1 33 pts. 10,734
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 27 pts. 10,732
  9. Avatar for mirp 9. mirp Lv 1 22 pts. 10,729
  10. Avatar for Xartos 10. Xartos Lv 1 17 pts. 10,728

Comments