1851: Revisiting Puzzle 134: Rice
Closed since over 5 years ago
Intermediate Overall PredictionSummary
- Created
- June 12, 2020
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.
Sequence:
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH
Top groups
-
100 pts. 10,785
-
-
-
-
-
-
-
-
-
-
1. Migi Lv 1100 pts. 10,767
-
-
-
-
-
-
-
-
-
Comments
jeff101 Lv 1
https://fold.it/portal/recipe/43861#comment-28861
says there are 105 different ways to make
4 disulfide bonds from 8 cysteines.
BarrySampson Lv 1
But if you use DiANNA or DISILFIND they only predict 4. But not the same ones!!