Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary

Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Russian team 11. Russian team 4 pts. 9,341
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 9,334
  3. Avatar for CHNO Junkies 13. CHNO Junkies 2 pts. 9,215
  4. Avatar for Kangwon_National_University_Computers_in_Chemistry 14. Kangwon_National_University_Computers_in_Chemistry 1 pt. 8,823
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,807
  6. Avatar for Team Canada 16. Team Canada 1 pt. 7,988
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 7,633
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 7,199
  9. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 7,134
  10. Avatar for Italiani Al Lavoro 20. Italiani Al Lavoro 1 pt. 2,801
  1. Avatar for kludbrook 91. kludbrook Lv 1 4 pts. 9,203
  2. Avatar for sitlux 92. sitlux Lv 1 4 pts. 9,196
  3. Avatar for chlorowolf 93. chlorowolf Lv 1 4 pts. 9,191
  4. Avatar for SKSbell 94. SKSbell Lv 1 4 pts. 9,190
  5. Avatar for Chris Klassen 95. Chris Klassen Lv 1 4 pts. 9,169
  6. Avatar for Steven Pletsch 96. Steven Pletsch Lv 1 3 pts. 9,161
  7. Avatar for Vinara 97. Vinara Lv 1 3 pts. 9,138
  8. Avatar for Dhalion 98. Dhalion Lv 1 3 pts. 9,133
  9. Avatar for tom2705 99. tom2705 Lv 1 3 pts. 9,121
  10. Avatar for BarrySampson 100. BarrySampson Lv 1 3 pts. 9,116

Comments