Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since over 5 years ago

Intermediate Overall Prediction

Summary

Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Russian team 11. Russian team 4 pts. 9,341
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 9,334
  3. Avatar for CHNO Junkies 13. CHNO Junkies 2 pts. 9,215
  4. Avatar for Kangwon_National_University_Computers_in_Chemistry 14. Kangwon_National_University_Computers_in_Chemistry 1 pt. 8,823
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,807
  6. Avatar for Team Canada 16. Team Canada 1 pt. 7,988
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 7,633
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 7,199
  9. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 7,134
  10. Avatar for Italiani Al Lavoro 20. Italiani Al Lavoro 1 pt. 2,801
  1. Avatar for mirp 11. mirp Lv 1 77 pts. 10,522
  2. Avatar for Aubade01 12. Aubade01 Lv 1 74 pts. 10,513
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 72 pts. 10,510
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 70 pts. 10,502
  5. Avatar for aznarog 15. aznarog Lv 1 68 pts. 10,449
  6. Avatar for LociOiling 16. LociOiling Lv 1 66 pts. 10,439
  7. Avatar for TurtleByte 17. TurtleByte Lv 1 65 pts. 10,427
  8. Avatar for pauldunn 18. pauldunn Lv 1 63 pts. 10,405
  9. Avatar for CharlieFortsConscience 19. CharlieFortsConscience Lv 1 61 pts. 10,383
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 59 pts. 10,378

Comments