Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary

Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Russian team 11. Russian team 4 pts. 9,341
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 9,334
  3. Avatar for CHNO Junkies 13. CHNO Junkies 2 pts. 9,215
  4. Avatar for Kangwon_National_University_Computers_in_Chemistry 14. Kangwon_National_University_Computers_in_Chemistry 1 pt. 8,823
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,807
  6. Avatar for Team Canada 16. Team Canada 1 pt. 7,988
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 7,633
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 7,199
  9. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 7,134
  10. Avatar for Italiani Al Lavoro 20. Italiani Al Lavoro 1 pt. 2,801
  1. Avatar for Pazithi 31. Pazithi Lv 1 42 pts. 10,276
  2. Avatar for Bletchley Park 32. Bletchley Park Lv 1 41 pts. 10,274
  3. Avatar for jobo0502 33. jobo0502 Lv 1 40 pts. 10,274
  4. Avatar for Scopper 34. Scopper Lv 1 39 pts. 10,269
  5. Avatar for pvc78 35. pvc78 Lv 1 37 pts. 10,261
  6. Avatar for RW-QuantumSec 36. RW-QuantumSec Lv 1 36 pts. 10,254
  7. Avatar for TastyMunchies 37. TastyMunchies Lv 1 35 pts. 10,251
  8. Avatar for nicobul 38. nicobul Lv 1 34 pts. 10,248
  9. Avatar for LastAndroid 39. LastAndroid Lv 1 33 pts. 10,243
  10. Avatar for drjr 40. drjr Lv 1 32 pts. 10,243

Comments