Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Russian team 11. Russian team 4 pts. 9,341
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 9,334
  3. Avatar for CHNO Junkies 13. CHNO Junkies 2 pts. 9,215
  4. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,807
  5. Avatar for Team Canada 16. Team Canada 1 pt. 7,988
  6. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 7,633
  7. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 7,199
  8. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 7,134
  9. Avatar for Italiani Al Lavoro 20. Italiani Al Lavoro 1 pt. 2,801

  1. Avatar for WBarme1234 41. WBarme1234 Lv 1 31 pts. 10,240
  2. Avatar for xythus 42. xythus Lv 1 30 pts. 10,228
  3. Avatar for christioanchauvin 43. christioanchauvin Lv 1 29 pts. 10,222
  4. Avatar for marsfan 44. marsfan Lv 1 28 pts. 10,185
  5. Avatar for g_b 45. g_b Lv 1 27 pts. 10,184
  6. Avatar for donuts554 46. donuts554 Lv 1 26 pts. 10,175
  7. Avatar for Phyx 47. Phyx Lv 1 25 pts. 10,166
  8. Avatar for Hustvedt 48. Hustvedt Lv 1 24 pts. 10,147
  9. Avatar for Blipperman 49. Blipperman Lv 1 23 pts. 10,116
  10. Avatar for ZeroLeak7 50. ZeroLeak7 Lv 1 23 pts. 10,109

Comments